PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA06G0044500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 404aa    MW: 44464 Da    PI: 4.3658
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA06G0044500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.11.5e-11188233247
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          WTteE+ +++++ + +G g Wk+I+  +   +t+ q+ s+ qky
  ORGLA06G0044500.1 188 RFWTTEEHRQFLRGLRVYGRGEWKSISMNFVRSKTPVQVSSHAQKY 233
                        56*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.601182238IPR017930Myb domain
SuperFamilySSF466893.44E-15184239IPR009057Homeodomain-like
SMARTSM007171.4E-9186236IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.1E-13187236IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.4E-9187235IPR009057Homeodomain-like
CDDcd001672.52E-8190234No hitNo description
PfamPF002493.0E-8190233IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MEWTAAEMDE ARSIVARLTN AYDSGTLVAG AGNGDTRHDR IVRELQAWLP WRTMDQLIGL  60
YIELMAEEPA AAQPQYFDAG AVVDPTFDFF NDHNNFLGMP PPPVQQADDH NMNNVVADAS  120
MNYYYGGGGA GGAMVFGGAP MGETVEQAAP PAPAPVPVVP VVMNRDDDEV NNQGGGRHRA  180
APTNTTRRFW TTEEHRQFLR GLRVYGRGEW KSISMNFVRS KTPVQVSSHA QKYFRRVESA  240
AADKQRYSIN DVGLNDDDDD DSAMDGTNIY SNNKFNNNFG GWQSLAFAGG HLEPVSGGAA  300
PRQVIAPASS SAAAMNSAAQ FWAPMLFNPQ IQQQFMQMQA QTQQAWNDQH MMMAAAPMEG  360
ATDTNFEPAG AANYYYQQQQ QEEEGGAYGV PADQWMMNQN NNMF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0028540.0AP002854.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0014B15.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642794.10.0PREDICTED: uncharacterized protein LOC107281372
TrEMBLI1PZY20.0I1PZY2_ORYGL; Uncharacterized protein
STRINGORGLA06G0044500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.23e-21MYB family protein